Color PPF · Ceramic Tint

Tesla Cybertruck · Matte Green Military

teslacybertruckppfceramic-tintmattegreenmilitarycolor-ppf

About this build

This Tesla Cybertruck came through our Los Angeles studio as an electric platform build — EV-specific spec considerations come into play: glass curvature, charge-port edges, and the way battery heat moves through the cabin all factor into the install plan. The matte finish is the call when the owner wants the car to read low-profile under daylight and refuse to flash highlights at night. Multi-service builds are sequenced deliberately — one finish has to fully cure before the next one goes on top, so the schedule reflects that order.

This angular electric pickup received a full color transformation using a military-inspired matte green protective film. Beyond the visual shift, the installation provides durable paint protection against road debris and daily wear. The material was carefully aligned along the vehicle's complex geometric panels to maintain uniform texture across every surface. Window glass was finished with heat-rejecting ceramic tint to balance privacy and interior comfort. Achieving consistent film tension across the sharp body lines required extensive edge work and precise trimming around the stainless steel panel transitions.

What we used on this Tesla

Why these finishes were combined

Tesla builds with several finishes work when each layer is planned in sequence: paint protection film keeps the exterior factory-perfect against road debris and UV, while ceramic tint cuts the heat soak that California sun pushes into a closed cabin.

What to expect after the install

Every Tesla build at our Los Angeles studio includes a written aftercare brief and direct text-line access to the installer for the first month. Questions about your specific build — get a quote or call (424) 207-4435.